PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Q3R6H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 360aa    MW: 41047.8 Da    PI: 6.3189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Q3R6HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.2e-51181442128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                  ppGfrFhP+deel+v+yL++++++++l++ ++i+e+d+yk++PwdLpkk+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++l++ +++
  Araip.Q3R6H  18 PPGFRFHPSDEELIVHYLQNRISSRPLPA-SIIAEIDLYKYNPWDLPKKALFGEEEWYFFSPRDRKYPNGLRPNRAAGSGYWKATGTDKPILTSyGSK 114
                  9****************************.89***************8888899**************************************998899 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +g+kk Lvfy gr pkg+ktdW+m+eyrl
  Araip.Q3R6H 115 RIGVKKALVFYLGRPPKGTKTDWIMNEYRL 144
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6311171IPR003441NAC domain
PROSITE profilePS5100560.01717171IPR003441NAC domain
PfamPF023656.8E-2618144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEEGGGDQHA SNSSYTFPPG FRFHPSDEEL IVHYLQNRIS SRPLPASIIA EIDLYKYNPW  60
DLPKKALFGE EEWYFFSPRD RKYPNGLRPN RAAGSGYWKA TGTDKPILTS YGSKRIGVKK  120
ALVFYLGRPP KGTKTDWIMN EYRLVDTITS PSRLKGSMRL DDWVLCRVRH KGYSSKNSCE  180
NQDNPCEPNM LPNLPRCDEG YPATNMNFHA DMITDYQYKD YQILASILVG GHVPTTESMS  240
SLNLKDGKGN DPITSVHEDG FHREDSSTTV SPLDCYFNSL KRKSNEDNQY ENLISFNRKL  300
NMETAMDDES SIINGGLNFY NQNQSQDDII FNKRAAEPSI NFQELKQSAF IGRYPQCSSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-711317713171NAC domain-containing protein 19
4dul_A2e-711317713171NAC domain-containing protein 19
1ut7_B2e-711317713171NO APICAL MERISTEM PROTEIN
1ut7_A2e-711317713171NO APICAL MERISTEM PROTEIN
1ut4_B2e-711317713171NO APICAL MERISTEM PROTEIN
1ut4_A2e-711317713171NO APICAL MERISTEM PROTEIN
3swp_D2e-711317716174NAC domain-containing protein 19
3swp_C2e-711317716174NAC domain-containing protein 19
3swp_B2e-711317716174NAC domain-containing protein 19
3swp_A2e-711317716174NAC domain-containing protein 19
3swm_D2e-711317716174NAC domain-containing protein 19
3swm_C2e-711317716174NAC domain-containing protein 19
3swm_B2e-711317716174NAC domain-containing protein 19
3swm_A2e-711317716174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1508918e-38AC150891.3 Medicago truncatula chromosome 2 clone mth2-76a9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169387.10.0PREDICTED: NAC domain-containing protein 92-like
TrEMBLA0A0B2QJI10.0A0A0B2QJI1_GLYSO; NAC domain-containing protein 29
TrEMBLK7M3780.0K7M378_SOYBN; Uncharacterized protein
STRINGGLYMA13G40251.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.13e-80NAC domain containing protein 25